Total number of results for Atractosteus spatula are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02291 |
HSQGTFTNDYSKYLDTRRAQDFVQWLMSTKRSGGIT
|
36 | Atractosteus spatula | Glucagon | Glucagon-36 | 3282974#Pollock H.G., Kimmel J.R., Ebner K.E., Hamilton J.W., Rouse J.B., Lance V., Rawitch A.B.#Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide.# Gen. Comp. Endocrinol. 69:133-140(1988). | |
| NP02292 |
HSQGTFTNDYSKYLDTRRAQDFVQWLMST
|
29 | Atractosteus spatula | Glucagon | Glucagon | 3311873#Pollock H.G., Kimmel J.R., Hamilton J.W., Rouse J.B., Ebner K.E., Lance V., Rawitch A.B.#Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide.#Gen. Comp. Endocrinol. 67:375-382(1987). | |
| NP02293 |
HADGTYTSDVSSYLQDQAAKKFVTWLKQGQDRRE
|
34 | Atractosteus spatula | Glucagon | Glucagon-like peptide | 3282974#Pollock H.G., Kimmel J.R., Ebner K.E., Hamilton J.W., Rouse J.B., Lance V., Rawitch A.B.#Isolation of alligator gar (Lepisosteus spatula) glucagon, oxyntomodulin, and glucagon-like peptide: amino acid sequences of oxyntomodulin and glucagon-like peptide.# Gen. Comp. Endocrinol. 69:133-140(1988). | |
| NP03795 |
YPPKPENPGEDAPPEELAKYYSALRHYINLITRQRY
|
36 | Atractosteus spatula | NPY | Pancreatic polypeptide | 3311873#Pollock HG, Kimmel JR, Hamilton JW, Rouse JB, Ebner KE, Lance V, Rawitch AB#Isolation and structures of alligator gar (Lepisosteus spatula) insulin and pancreatic polypeptide#Gen Comp Endocrinol 1987 Sep;67(3):375-82 |